PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00081.1.g00090.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 87aa    MW: 9179.42 Da    PI: 10.5908
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00081.1.g00090.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.94.9e-323585151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a++ifss+g+lyeys+
  Zpz_sc00081.1.g00090.1.sm.mk 35 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALVIFSSRGRLYEYSN 85
                                  79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.8E-352886IPR002100Transcription factor, MADS-box
CDDcd002654.82E-352986No hitNo description
PRINTSPR004044.6E-292949IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-263386IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.9173387IPR002100Transcription factor, MADS-box
PfamPF003194.2E-273683IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-294964IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-296485IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MSSSPGSGSV GGASAAAAAA AAAENKAPGK GKQIKRIENT TNRQVTFCKR RNGLLKKAYE  60
LSVLCDAEIA LVIFSSRGRL YEYSNNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-193084458Myocyte-specific enhancer factor 2B
1tqe_Q3e-193084458Myocyte-specific enhancer factor 2B
1tqe_R3e-193084458Myocyte-specific enhancer factor 2B
1tqe_S3e-193084458Myocyte-specific enhancer factor 2B
3mu6_A3e-193084357Myocyte-specific enhancer factor 2A
3mu6_B3e-193084357Myocyte-specific enhancer factor 2A
3mu6_C3e-193084357Myocyte-specific enhancer factor 2A
3mu6_D3e-193084357Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0027253e-71KJ002725.1 Phyllostachys edulis MADS-box protein 58 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960599.16e-37PREDICTED: MADS-box transcription factor 58
SwissprotP293858e-35AGL5_ARATH; Agamous-like MADS-box protein AGL5
TrEMBLK3ZAE54e-38K3ZAE5_SETIT; Uncharacterized protein
STRINGSi023516m1e-37(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.24e-34MIKC_MADS family protein